PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA4G00041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 290aa    MW: 32218.9 Da    PI: 6.6373
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA4G00041genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.4e-073580346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT+ E + + +a + +  +   +W ++a+ ++ g+t ++++  ++ 
        AA4G00041 35 TWTEAENKAFENALAVYDDNtpdRWQKVAAVIP-GKTVNDVIKQYNE 80
                     5*****************99*************.********99986 PP

2Myb_DNA-binding45.91.3e-14140184347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
        AA4G00041 140 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 184
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.5563186IPR017884SANT domain
SMARTSM007178.2E-93284IPR001005SANT/Myb domain
PfamPF002494.5E-63580IPR001005SANT/Myb domain
CDDcd001677.42E-83581No hitNo description
SuperFamilySSF466896.53E-113589IPR009057Homeodomain-like
PROSITE profilePS5129420.772133189IPR017930Myb domain
SuperFamilySSF466897.25E-17135188IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17136188IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-12137184IPR009057Homeodomain-like
SMARTSM007173.2E-13137187IPR001005SANT/Myb domain
PfamPF002495.0E-13140184IPR001005SANT/Myb domain
CDDcd001673.61E-11140185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEILRPTGHV VSGGNWLLEE SKNNFTMIVA AEGATWTEAE NKAFENALAV YDDNTPDRWQ  60
KVAAVIPGKT VNDVIKQYNE LEADVSSIEA GLIPVPGYIT SPFTLDWTGG CNGFKPGFPV  120
NNKRSPSSRP PELERKKGVP WTEEEHKLFL MGLKKYGKGD WRNISRNFVI TRTPTQVASH  180
AQKYFIRQLS GGKDKRRASI HDITTVNLED EVTLETNKTN SAINGVSVRR REEERSAFHW  240
RPADTNNGSA EDAFNMTIGN AVNSVHSYGH GLIGAFNNAD SCFDAQNAMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1733101876RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401027.11e-164hypothetical protein EUTSA_v10014270mg
SwissprotQ8S9H71e-101DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A087GC161e-171A0A087GC16_ARAAL; Uncharacterized protein
STRINGBra006741.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-160Homeodomain-like transcriptional regulator